DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG7829

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:231 Identity:67/231 - (29%)
Similarity:101/231 - (43%) Gaps:28/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADS--VTVYFGAT--WRTN 99
            ||..|:||:....||.|.:...|...||||||.:..:|||.||:.....  :.|..|.|  :|.:
  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKD 91

  Fly   100 AQF-------THWVGNGNF-IKHSSADIALIRIPHVDFWHMVNKVE-LPSYNDRYNDYNEWWAVA 155
            .:.       .|    .|| .|....||.:||:  .....:..||: :|...:|..:..  :|..
  Fly    92 GELFSVADLQVH----ENFNPKTMDYDIGIIRL--TKNLTLSRKVKAIPINPERVAEGT--YATI 148

  Fly   156 CGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCV-RTPDGKSTCGGDSGGPLVTH 218
            .|||......|..|.|:...:.|::.:.|....| :|.|.:||. ....|...|..||||||...
  Fly   149 AGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVR 213

  Fly   219 DGTKLVGVTNFGSVAGCQ-SGAPAGFQRVTYHLDWI 253
            :  :|||:.::|  .||. :..|..:.|:.....|:
  Fly   214 E--QLVGIVSWG--VGCALADKPGVYSRLDALHPWL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/229 (29%)
Tryp_SPc 40..256 CDD:238113 66/230 (29%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 66/228 (29%)
Tryp_SPc 28..248 CDD:238113 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.