DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG11841

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:274 Identity:63/274 - (22%)
Similarity:98/274 - (35%) Gaps:93/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLGFSG-----GWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTN 99
            |.:|.|||..:.|:...||...     .|:|||::|::..||||.||.                 
  Fly    72 IVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGGTLISNRLVLTAAHCF----------------- 119

  Fly   100 AQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYN-------------DRYND---- 147
                       |.:|  .::.::|:..::|....:..|...:.             ..|||    
  Fly   120 -----------FSEH--GEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIV 171

  Fly   148 -------YNEWWAVAC---------------GWGGTYDGSPLPDYLQCVDLQ---------IIHN 181
                   :|.:...||               |||...........|..|.||         :..|
  Fly   172 QLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDAN 236

  Fly   182 SECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGT-----KLVGVTNFGSVAGCQS-GAP 240
            .|....|.....  ||:.:.|.|.||.||||||::.:...     .::|:|:.|..  |.: ..|
  Fly   237 DELPNGYEPKSQ--LCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGIT--CSTPDIP 297

  Fly   241 AGFQRVTYHLDWIR 254
            :.:.||.|.|:||:
  Fly   298 SAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/271 (23%)
Tryp_SPc 40..256 CDD:238113 63/274 (23%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/272 (23%)
Tryp_SPc 72..310 CDD:214473 61/271 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.