DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG4815

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:114/277 - (41%) Gaps:60/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SGATMPRLATEKLTPVHT-----KDMQG----RITNGYPAEEGKAPYTV----GLG---FSG-GW 63
            ||.|:.||.. .|..|.|     ::..|    ||.||...       ||    |:|   |:| ..
  Fly     3 SGWTLVRLLL-ILNSVRTEAGNREEWTGRFHPRIYNGIKT-------TVESLGGVGIQLFNGRKL 59

  Fly    64 WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIP-HV 127
            .|..:::....:|||.||..:.:...  |......:|:|| |.|| ||.|:.     |||:. |.
  Fly    60 VCSATLLTPRHILTAAHCFENLNRSK--FHVIGGKSAEFT-WHGN-NFNKNK-----LIRVQIHP 115

  Fly   128 DFWHM-------VNKVELPSYNDRYNDYNEWW---------AVACGW---GGTYDGSPLPDYLQC 173
            .:..|       |.|.:.| ...:|..|.:..         .:|.||   ||.:|.|....: :.
  Fly   116 KYAKMKFIADVAVAKTKYP-LRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESRKKTF-RS 178

  Fly   174 VDLQIIHNSECSGYYG-SVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQS 237
            :.:.|:...:|..... .:..||:|....:.|:.|.|||||||:.  |.::.|:..:....| .:
  Fly   179 MKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLL--GRQVCGINTWTFKCG-NN 240

  Fly   238 GAPAGFQRVTYHLDWIR 254
            ..|..:..|.|:..:|:
  Fly   241 EKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/242 (26%)
Tryp_SPc 40..256 CDD:238113 63/244 (26%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 57/223 (26%)
Trypsin 49..256 CDD:278516 56/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.