DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and grass

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:256 Identity:70/256 - (27%)
Similarity:105/256 - (41%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGF----SGGWWCGGSIIAHDWVLTAEHCIG--DADSVTVYFG---- 93
            |::|||..:....|:...|.:    ...:.|||::|:..::|||.||:.  ..|...:..|    
  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRI 182

  Fly    94 ATWRTNAQ----------------FTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELPSY 141
            :|.....|                ..|.:......:|...||||:::.. |.|...:..:.|| .
  Fly   183 STEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLP-I 246

  Fly   142 NDRYNDYNEWWAV--ACGWGGTYDGSPLPDYLQC-VDLQIIHNSECS-GYYGSVGDNILCVRTPD 202
            .|...:..|..:.  ..|||.|.:||.....||. |.||  ..|.|| .|..:|..:.|||...|
  Fly   247 TDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQ--PRSACSQAYRRAVPLSQLCVGGGD 309

  Fly   203 GKSTCGGDSGGPL------VTHDGTKLV--GVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255
            .:.:|.|||||||      :.....|:|  |:.:.|.|...|...|..:..|..::.||.|
  Fly   310 LQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLYTNVGEYVQWITD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/252 (27%)
Tryp_SPc 40..256 CDD:238113 69/255 (27%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 69/253 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.