DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss9

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:249 Identity:72/249 - (28%)
Similarity:110/249 - (44%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQF 102
            |||..|..|..|:.|:.|.|..:...:||.:||...|:::|.||..:...     .|.|...|..
Mouse   454 GRIVGGVEAAPGEFPWQVSLRENHEHFCGATIIGARWLVSAAHCFNEFQD-----PAQWAAQAGS 513

  Fly   103 THWVGNG---------NFIKH-------SSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNE 150
            .|..|:.         ...||       :..|:|::.:.. :.|...|....||:....:....:
Mouse   514 VHLSGSEASAVRTRVLRIAKHPAYDADTADFDVAVLELARPLPFGRYVQPACLPAATHVFPPGKK 578

  Fly   151 WWAVACGWGGTY---DGSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCVRTPDGK-STCGGD 210
              .:..|||  |   |....|:.||...::::..|.||..|| |:.|.::|....||| .:|.||
Mouse   579 --CLISGWG--YLKEDFLVKPEVLQKATVELLDQSLCSSLYGHSLTDRMVCAGYLDGKVDSCQGD 639

  Fly   211 SGGPLVTHDGTK---LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDHTGIA 260
            ||||||..:.:.   |.|:.::|  .|| ::..|..:.|||...|||.:.|..|
Mouse   640 SGGPLVCEEPSGRFFLAGIVSWG--IGCAEARRPGVYTRVTRLRDWILEVTSAA 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/239 (28%)
Tryp_SPc 40..256 CDD:238113 68/241 (28%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473 67/239 (28%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.