DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG11836

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:245 Identity:75/245 - (30%)
Similarity:114/245 - (46%) Gaps:42/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI------------GDAD-SVTV 90
            ||..|.|....:.|:...:.:.|.:.||||::..|:||:|.||:            ||.| .:|.
  Fly    96 RIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITS 160

  Fly    91 YFGATWRTNAQFTHWVGNGNFIKHSS-------ADIALIRI-PHVDFWHMVNKVELPSYNDRYND 147
            ...|..|....         .|||.|       .||||:|: ..:.|..::..:.||.||  |:.
  Fly   161 ESQAIQRAVTA---------VIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRYN--YDP 214

  Fly   148 YNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGY-YGS--VGDNILCVRTPDGKSTCGG 209
            ......|. |||.|.:|..||..:..|.:.|:..:||... |.|  :..::||...| ...:|.|
  Fly   215 AGRIGTVV-GWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRP-SMDSCQG 277

  Fly   210 DSGGPLVTHDGTK--LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDH 256
            ||||||:..:|.|  :||:.::|  .|| :.|.|..:.||:..:.||:.:
  Fly   278 DSGGPLLLSNGVKYFIVGIVSWG--VGCGREGYPGVYSRVSKFIPWIKSN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/240 (30%)
Tryp_SPc 40..256 CDD:238113 74/242 (31%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.