DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG10232

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:289 Identity:69/289 - (23%)
Similarity:101/289 - (34%) Gaps:102/289 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NGYPAEEGKAP--YTVGLGFSG-----GWW----------------CGGSIIAHDWVLTAEHCI- 82
            |..|...|:||  |.:..|.:.     .|.                |.||:|...:||||.||: 
  Fly   242 NVLPTSCGQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVV 306

  Fly    83 ----------------GDADSVTVYFGATWRTNAQFTHWVGNGN------------FIKHS---- 115
                            |:.|..|       ..:..||     ||            |..|.    
  Fly   307 KDKMVNTDLVLRRVRLGEHDITT-------NPDCDFT-----GNCAAPFVEIGIEYFNVHEQYFN 359

  Fly   116 ----SADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVD 175
                .:||||:|: ..|.:.|.:..:.:|  .|....:|....:| |||.|.:    .:|.|.  
  Fly   360 TSRFESDIALVRLQTPVRYTHEILPICVP--KDPIPLHNHPLQIA-GWGYTKN----REYSQV-- 415

  Fly   176 LQIIHNSECSG-YYGSVGDNI--------LCVRTPDGKSTCGGDSGGPLVT------HDGTKLVG 225
              ::||:.... ||  ..|.|        :|.....|:.:|.|||||||:.      .|...|.|
  Fly   416 --LLHNTVYENRYY--CQDKISFFRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAG 476

  Fly   226 VTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            :.::|| ..|....|..:.:......||:
  Fly   477 IVSYGS-ENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/286 (23%)
Tryp_SPc 40..256 CDD:238113 69/289 (24%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 63/271 (23%)
Tryp_SPc 260..503 CDD:214473 61/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.