DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and SPE

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:239 Identity:65/239 - (27%)
Similarity:98/239 - (41%) Gaps:58/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIIAHDWVLTAEHCIGDAD---------SVTVYFGATW--RTNAQFTHWVGNGNFI---KH- 114
            |||:::...:||||.||:...:         ||.:   ..|  ||:...|..: ||..|   || 
  Fly   166 CGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRL---GEWDTRTDPDCTTQM-NGQRICAPKHI 226

  Fly   115 -------------------SSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG 159
                               ...||||:|:.. |.:...|..:.||:.....|::.::.....|||
  Fly   227 DIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWG 291

  Fly   160 GTYDGSPLPDYLQCVDLQIIHN----SECSGYYGS----VGDNILCVRTPDGKSTCGGDSGGPLV 216
            .|.:..|     ..:.|:|..|    :.|...|.|    :.|:.:|.....|..||||||||||:
  Fly   292 LTENMQP-----SAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLM 351

  Fly   217 T------HDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            .      .|...:.|||::|:......|.|..:.|....:|||:
  Fly   352 VPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/236 (27%)
Tryp_SPc 40..256 CDD:238113 65/239 (27%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 65/239 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.