DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG31199

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:168 Identity:37/168 - (22%)
Similarity:59/168 - (35%) Gaps:57/168 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQG----------RITNGYPAE-EGKAPYTVGLG 58
            ||:|.|.|    |...|.:.:.|:    ..|..|          :.|...|.| :..|....|.|
  Fly     5 IAVLLLLV----GLFGPEVRSAKV----NDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKG 61

  Fly    59 FSG-----GWWCGGSIIAHDWVLTAEHCI----GDADSVTVYFGATWRTNAQFTHWVGNGNFIKH 114
            |.|     |  |.|.:::...||...||.    |.|::.:|:.|                  :.:
  Fly    62 FEGKIRDNG--CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLG------------------VHN 106

  Fly   115 SSADIALIRIPHVDFWHMVNKVEL--------PSYNDR 144
            .||.:. :|:...|.:.:....|:        |.|:.|
  Fly   107 KSAPVG-VRVCETDGYCVRPSQEIKLAEIAIHPDYDSR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 27/124 (22%)
Tryp_SPc 40..256 CDD:238113 27/123 (22%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.