DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG7432

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:274 Identity:82/274 - (29%)
Similarity:110/274 - (40%) Gaps:81/274 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGYPAEEGKAPYTVGLGFSG----GWWCGGSIIAHDWVLTAEHC----------------- 81
            |||..|..|..|:.|:...:...|    .:|||||:|...::|||.||                 
  Fly   473 GRIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVR 537

  Fly    82 IGDADSVT-------VYFGA-TWRTNAQFTHWVGNGNFIKHSSADIAL----------------- 121
            :||.|..|       |.|.. ..||:.:|:. :|..|       |||:                 
  Fly   538 LGDIDLSTDAEPSDPVTFAVKEVRTHERFSR-IGFYN-------DIAILVLDKPVRKSKYVIPVC 594

  Fly   122 ----IRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNS 182
                ||:|        .|..||...          |...|||.||.|.......:..:|.|..|.
  Fly   595 LPKGIRMP--------PKERLPGRR----------ATVVGWGTTYYGGKESTSQRQAELPIWRNE 641

  Fly   183 ECS-GYYGSVGDNILCVRTPD-GKSTCGGDSGGPLVTHDGTKLV--GVTNFGSVAGCQSGAPAGF 243
            :|. .|:..:.:|.:|....| |...|.|||||||:....:..|  ||.:||:..| :.|.|..:
  Fly   642 DCDRSYFQPINENFICAGYSDGGVDACQGDSGGPLMMRYDSHWVQLGVVSFGNKCG-EPGYPGVY 705

  Fly   244 QRVTYHLDWIRDHT 257
            .|||.:||||||||
  Fly   706 TRVTEYLDWIRDHT 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/267 (28%)
Tryp_SPc 40..256 CDD:238113 77/269 (29%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 75/267 (28%)
Tryp_SPc 475..718 CDD:238113 77/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.