DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG31219

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:298 Identity:71/298 - (23%)
Similarity:95/298 - (31%) Gaps:140/298 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NGYPAEEGKAPYTVGLGFSGGW----------------WCGGSIIAHDWVLTAEHCIG----DAD 86
            ||||                 |                :|.||:|.:.:|||:.||:.    |..
  Fly    98 NGYP-----------------WMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLS 145

  Fly    87 SVTVYFG---------------------ATWRTNAQFTHWVGNGNFIKHSSA----DIALIR--- 123
            ..:|..|                     |......:....:.:|.|...|:.    ||||:|   
  Fly   146 LKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKM 210

  Fly   124 ------------IPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS----------- 165
                        ||...|: ..:|:|:                 .|||.|.:|.           
  Fly   211 PVRYRTGIMPICIPKHGFF-AKSKLEI-----------------AGWGKTNEGQFSQVLMHGFIR 257

  Fly   166 -----------PLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPL-VTH 218
                       |..|..|  .|||     |:|.|             ||..||.||||||| ||.
  Fly   258 ERSIAVCALRFPYLDLNQ--SLQI-----CAGGY-------------DGVDTCQGDSGGPLMVTM 302

  Fly   219 DGTK--LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            |.:.  |.|:|.:||....|.|.|..:.|.:..|.||:
  Fly   303 DNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/295 (23%)
Tryp_SPc 40..256 CDD:238113 71/298 (24%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 69/295 (23%)
Tryp_SPc 90..342 CDD:238113 71/298 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.