DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG7142

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:242 Identity:63/242 - (26%)
Similarity:96/242 - (39%) Gaps:48/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 APYTVGLGFSGG-----WWCGGSIIAHDWVLTAEHCIGD----------ADSVTVYFGATWRTNA 100
            |||.|.:.....     .:|.|:||...|:|||.||:..          |.|..::......:|.
  Fly    91 APYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNI 155

  Fly   101 QFTHWVGNGNFIKH-------SSADIALI--RIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVAC 156
            |..|   ...:::|       :..|||||  :.|.| |...|....||..:.:...|...:    
  Fly   156 QMRH---IDYYVRHELYLGGVNPYDIALIYTKEPLV-FDTYVQPATLPEQDAQPEGYGTLY---- 212

  Fly   157 GWGGTYDGSPLPDY---LQCVDLQIIHNSECSGYYGSVG----DNILCV-RTPDGKSTCGGDSGG 213
            |||.. ..:.:|:|   ||..::.|:....|.......|    :..||. ....|.|.|..||||
  Fly   213 GWGNV-SMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGG 276

  Fly   214 PLVT-------HDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            ||:.       .....::|:.::|.:...|..||:.|.||:...:||
  Fly   277 PLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/240 (25%)
Tryp_SPc 40..256 CDD:238113 63/242 (26%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 63/242 (26%)
Tryp_SPc 84..323 CDD:214473 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.