DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG5255

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:286 Identity:82/286 - (28%)
Similarity:124/286 - (43%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATM---PRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTV---GLGFSGGW 63
            :.:|.|.:.::|.|:.   |        |.:||:   ||..|..|..|.|||.:   |:| ||..
  Fly     3 LILLPLVLFTSSAASQILYP--------PQYTKN---RIVGGEEAAAGLAPYQISLQGIG-SGAH 55

  Fly    64 WCGGSIIAHDWVLTAEHCI--GDADSVTVYFGATWRTNAQFTHWVGN-----GNFIKHSS----- 116
            .|||:||...|::||.||.  ..|.:..|.      |..|..|..|:     ...::||:     
  Fly    56 SCGGAIIDERWIITAAHCTRGRQATAFRVL------TGTQDLHQNGSKYYYPDRIVEHSNYAPRK 114

  Fly   117 --ADIALIRI-PHVDFWHMVNKVEL------PSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQ 172
              .||||:.: ..:.|.:....|||      |...          .:..|||....|..:|..||
  Fly   115 YRNDIALLHLNESIVFDNATQPVELDHEALVPGSR----------LLLTGWGTLSLGGDVPARLQ 169

  Fly   173 CVDLQIIHNSECSGYYGS---VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAG 234
            .:::..:...:|...:.:   |....:|.....|:..|.|||||||| |:| |||.:.|:|  ..
  Fly   170 SLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNG-KLVALVNWG--LP 230

  Fly   235 CQSGAPAGFQRVTYHLDWIRDHTGIA 260
            |..|.|.....::|:.|:||.|..::
  Fly   231 CAKGYPDAHASISYYHDFIRTHLSLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/240 (30%)
Tryp_SPc 40..256 CDD:238113 72/242 (30%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 71/240 (30%)
Tryp_SPc 30..252 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436773
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.