DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG31266

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:312 Identity:84/312 - (26%)
Similarity:122/312 - (39%) Gaps:112/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASGAT---------MPRLA-------TEKLTPVHTKDMQGRITNGYPAEEGKAPYTV 55
            :|.|.:.:..|.|         :|.||       ||.:.       |||:..|..|.||..|:..
  Fly    10 LLGLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVP-------QGRVIGGTTAAEGNWPWIA 67

  Fly    56 GLGFSGGW-WCGGSIIAHDWVLTAEHCI------------GDADSVTVYFGATWRTNAQF-THWV 106
            .:..:..: .||..|:...|||||..|:            |..|...:|  |.:.|.:|. .|. 
  Fly    68 SIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLY--APYYTVSQIHVHC- 129

  Fly   107 GNGNFIK---HSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVA------------- 155
               ||.|   |:  ||||:::.        :|:|       :||..:...:|             
  Fly   130 ---NFDKPLYHN--DIALLQLS--------SKIE-------FNDVTKNITLADIDELEEGDKLTF 174

  Fly   156 CGWG-----GTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVG---------DNI----LCVRTPD 202
            .|||     |||.     .|||          |.||.|..|.         |::    :||:...
  Fly   175 AGWGSSEAMGTYG-----RYLQ----------EASGTYLPVDACREKLQNQDDVDLGHVCVQMDA 224

  Fly   203 GKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            |:..|.||:||||: .:..:|||:.|:|  ..|..|.|..:.|..::.||||
  Fly   225 GQGACHGDTGGPLI-DEQQRLVGIGNWG--VPCGRGYPDVYARTAFYHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/261 (27%)
Tryp_SPc 40..256 CDD:238113 72/263 (27%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/261 (27%)
Tryp_SPc 52..275 CDD:238113 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.