DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG17477

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:232 Identity:75/232 - (32%)
Similarity:106/232 - (45%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGL-GFSGGWWCGGSIIAHDWVLTAEHCIG-------DADSVTVYF---G 93
            |..|..|.||.|||.|.| ...|...|||:||:..|::||.||:.       ...:.|:.:   |
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG 91

  Fly    94 ATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACG 157
            |.:..:|.:.|.  |.:..|:.: ||.|:.: ..:.|..:...||||: :......:|  .|..|
  Fly    92 AVYYPDAIYLHC--NYDSPKYQN-DIGLLHLNESITFNALTQAVELPT-SPFPRGASE--LVFTG 150

  Fly   158 WGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS-----VGDNILCVRTPDGKSTCGGDSGGPLVT 217
            ||.......||..||.|..|.:::..|.....:     :|...:|.........|.|||||||| 
  Fly   151 WGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLV- 214

  Fly   218 HDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            |.|| |||:.||  ...|..|.|..|..:.|:.||:|
  Fly   215 HQGT-LVGILNF--FVPCAQGVPDIFMNIMYYRDWMR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/229 (32%)
Tryp_SPc 40..256 CDD:238113 75/232 (32%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 75/232 (32%)
Tryp_SPc 27..246 CDD:214473 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.