DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG10405

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:279 Identity:76/279 - (27%)
Similarity:118/279 - (42%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIA 71
            ||.:..||.:.|.:||            ....||.||..|.||:.||.:.|.......||.||::
  Fly    16 ILVILEASRTEAAVPR------------QPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILS 68

  Fly    72 HDWVLTAEHCIGDAD----SVTVYFGATWRTN--------AQFTHWV---GNGNFIKHSSADIAL 121
            .:|.:||.|||...:    ..|:..|:..||:        |.:.|..   .:.||      |:||
  Fly    69 SNWAITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNF------DVAL 127

  Fly   122 IR-------IPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSP-LPDYLQCVDLQI 178
            :|       :|    ...|..:.||:..:..::  ...||..|||.....:| |...|:...:..
  Fly   128 LRTADGALSLP----LGKVAPIRLPTVGEAISE--SMPAVVSGWGHMSTSNPVLSSVLKSTTVLT 186

  Fly   179 IHNSECSG---YYGSVGDNILC--VRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSG 238
            ::..:|..   ::|.|.:.:.|  .|..|   .|.|||||| ::..|| |:|:.::|  .||...
  Fly   187 VNQEKCHNDLRHHGGVTEAMFCAAARNTD---ACQGDSGGP-ISAQGT-LIGIVSWG--VGCADP 244

  Fly   239 -APAGFQRVTYHL--DWIR 254
             .|..:.|:.:..  .|||
  Fly   245 YYPGVYTRLAHPTIRRWIR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/244 (27%)
Tryp_SPc 40..256 CDD:238113 68/246 (28%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 66/244 (27%)
Tryp_SPc 37..263 CDD:238113 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.