DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and ea

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:296 Identity:74/296 - (25%)
Similarity:113/296 - (38%) Gaps:74/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PRLATEKLTPVHTK---DMQGRITNGYPAEEGKAP------YTVGLGFSGGWWCGGSIIAHDWVL 76
            |.:.:..|.|:..:   .:..||..|...:..:.|      ||...| ..|..||||:|:..:|:
  Fly   106 PNVTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQG-KKGHHCGGSLISTRYVI 169

  Fly    77 TAEHCIGDADSVTVYFGATWR-TNAQFTHWVGNGN------------------------------ 110
            ||.||:......|     .|| :..:...|..|.|                              
  Fly   170 TASHCVNGKALPT-----DWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPD 229

  Fly   111 FI---KHSSADIALIRI-PHVDFWHMVNKVELP-SYNDRYNDYNEWWAVACGWGGTYDGSPLPDY 170
            :|   |:...||||:|: ..|::...|..:.|| ..|.|...::.......|||.|       :.
  Fly   230 YIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKT-------EQ 287

  Fly   171 LQCVDLQI------IHNSECSGYYGS----VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK--- 222
            |...:|::      ....||...|.|    :.|..:|....:|..:|.|||||||:..|..|   
  Fly   288 LSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNT 352

  Fly   223 ---LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255
               |.||.:||......:|.|..:..|..::|||::
  Fly   353 YYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/271 (25%)
Tryp_SPc 40..256 CDD:238113 70/274 (26%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 69/271 (25%)
Tryp_SPc 128..389 CDD:238113 70/274 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
11.000

Return to query results.
Submit another query.