DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG9649

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:96/253 - (37%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGL----GFSGGWWCGGSIIAHDWVLTAEHCI--------GDADSVTV-- 90
            |.||...|.|:.|:...|    |....:.|||::|:...|::|.||.        |:...|::  
  Fly   257 IHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGR 321

  Fly    91 ------YFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIP-HVD---------FWHMVNKVELP 139
                  ..|||........|...|.|.  ::.||:||:::. |||         .|:....:|||
  Fly   322 NSLDLFSSGATLGVARLLIHEQYNPNV--YTDADLALLQLSNHVDIGDYIKPICLWNENFLLELP 384

  Fly   140 SYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS-----VGDNILCVR 199
            |.:..|         ..|||....|:......:..|..||...||.|....     :..:.:|..
  Fly   385 SGHKSY---------VAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICAS 440

  Fly   200 TPDGKSTCGGDSGGPLV--THDGTKLVGVTNFGS--VAGCQSGAPAGFQRVTYHLDWI 253
            .......|.|||||.|:  ..|...|.||.:.|.  ...|....|..:..|..|::|:
  Fly   441 NAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 64/251 (25%)
Tryp_SPc 40..256 CDD:238113 65/253 (26%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 64/251 (25%)
Tryp_SPc 259..497 CDD:214473 63/248 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.