DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG8870

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:92/245 - (37%) Gaps:78/245 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR-----TNAQFTHWVGNG--------------N 110
            ||||:|.:.:||||.||:........|...|.|     |:......:.||              .
  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181

  Fly   111 FIKHSS--------ADIALIRIPH-VDFWHMVNKVELP------SYNDRYNDYNEWWAVACGWGG 160
            .|.|..        .||||:|:.. |.:...:..:.||      ::..::.        |.||  
  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQ--------ASGW-- 236

  Fly   161 TYDGSPLPDYLQCVDLQII--------HNSEC-SGYYGSVGDNILCVRTPDGKSTCGGDSGGPL- 215
                   ||..|.:..:::        |...| |.|..::|..| |....||..|..||||||| 
  Fly   237 -------PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNLGSQI-CAGGLDGNDTSPGDSGGPLM 293

  Fly   216 -------VTHDGTKLVGVTNFGS----VAGCQSGAPAGFQRVTYHLDWIR 254
                   ||.  |...|:.::|.    :..|:   ||.:.:.:|..:||:
  Fly   294 ETVIRGKVTL--TYAAGIISYGQKPCVLKTCK---PAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 59/242 (24%)
Tryp_SPc 40..256 CDD:238113 61/245 (25%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 61/245 (25%)
Tryp_SPc 93..337 CDD:214473 59/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.