DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and snk

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:264 Identity:72/264 - (27%)
Similarity:102/264 - (38%) Gaps:72/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLGFSGG---------WWCGGSIIAHDWVLTAEHCI--GDADSVTVYFG 93
            |..|.|...|..|:...||::.|         |.|||::::..:||||.||.  |......|..|
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250

  Fly    94 ATWRTNAQFTHWVGNGNFIK----------HSSA---DIALIRIP-HVDFWHMVN--------KV 136
            |     .|..........||          .|||   ||||:::. .|.|...|.        ::
  Fly   251 A-----RQLNETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPEL 310

  Fly   137 ELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY--------GSVGD 193
            ::|:            .||.|||.|.......:.|:.|||.::....|...|        |.:..
  Fly   311 QIPT------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEG 363

  Fly   194 NILCVRTPDGKSTCGGDSGGPL---------VTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYH 249
            .......|.|:.||.||||||:         |..    :||:|:||......: ||..:.|:..:
  Fly   364 QFCAGYLPGGRDTCQGDSGGPIHALLPEYNCVAF----VVGITSFGKFCAAPN-APGVYTRLYSY 423

  Fly   250 LDWI 253
            ||||
  Fly   424 LDWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/262 (27%)
Tryp_SPc 40..256 CDD:238113 72/264 (27%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 72/264 (27%)
Tryp_SPc 186..427 CDD:214473 70/262 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.