DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and ela2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001132936.1 Gene:ela2 / 403061 ZFINID:ZDB-GENE-041117-1 Length:266 Species:Danio rerio


Alignment Length:273 Identity:81/273 - (29%)
Similarity:116/273 - (42%) Gaps:40/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGG----WWC 65
            :.||||.:|.|.|...|..          |.:..|:..|........|:...|.:..|    ..|
Zfish     3 LVILALFIAGAYGCGQPTY----------KPIDSRVVGGSDVRPNSWPWQASLQYQSGSSFYHTC 57

  Fly    66 GGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGN-----GNFIKHSS-------AD 118
            ||::|...|||||.|||    |...|.....:.|...:...|:     ...|.|.:       .|
Zfish    58 GGTLIDKQWVLTAAHCI----SSRTYRVLLGKHNLPLSSESGSQAISPARIIVHENWDSYNIRND 118

  Fly   119 IALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNS 182
            ||||:: ..|.|...::...||.........:..:..  |||..:.|.|:.|.||...|.|:..:
Zfish   119 IALIKLSTPVTFTDKISPACLPDSGSILPHNSPCYVT--GWGRLWTGGPIADILQQALLPIVDQA 181

  Fly   183 EC--SGYYGS-VGDNILCVRTPDGKSTCGGDSGGPL--VTHDGT-KLVGVTNFGSVAGCQ-SGAP 240
            .|  |.::|: |.|.::|.......|:|.|||||||  ...||| .:.|:.:|||..||. ...|
Zfish   182 TCTKSDWWGNLVTDLMVCAGGDGVVSSCNGDSGGPLNCQRRDGTWDVHGIVSFGSSLGCNYPKKP 246

  Fly   241 AGFQRVTYHLDWI 253
            :.|.||:.::.||
Zfish   247 SVFTRVSGYIPWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/237 (30%)
Tryp_SPc 40..256 CDD:238113 71/238 (30%)
ela2NP_001132936.1 Tryp_SPc 27..259 CDD:214473 70/237 (30%)
Tryp_SPc 28..262 CDD:238113 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.