DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG14088

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:214 Identity:43/214 - (20%)
Similarity:63/214 - (29%) Gaps:91/214 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTA-------------- 78
            ||.||..|..| :......|.|:.               ||.:|.|.::.|              
  Fly    69 LTDVHCGDSIG-VIRARLGEYGRI---------------GSELAEDHIVAAFFSNANFNPETQAN 117

  Fly    79 --------------EH----CI-------GDADSVTVYFGATWRTN--------------AQFTH 104
                          ||    ||       ..||.:..:.|.||:.:              .|...
  Fly   118 NMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFNGTTWKNSDKSPMLRSKTVIRMPQACG 182

  Fly   105 WVGNGNFIK-HSSAD-------IALIRIPHVDF--------WHMVNKVELPSYNDR-YND---YN 149
            .:.:|.|.. |...|       .||.|  .:|:        :.:.|.||:...|.| |.|   .:
  Fly   183 KLDHGQFCAGHKDLDSCDEPSGAALTR--EIDYIGPNRTVLFGIANSVEVKCSNSRTYTDVVQLH 245

  Fly   150 EWWAVACGWGGTYDGSPLP 168
            :|.::......|.||...|
  Fly   246 QWISMVIYSSNTNDGMDKP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 37/203 (18%)
Tryp_SPc 40..256 CDD:238113 37/202 (18%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 39/199 (20%)
Tryp_SPc 42..248 CDD:214473 38/196 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.