DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG7542

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:276 Identity:107/276 - (38%)
Similarity:147/276 - (53%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFS-GGW- 63
            ||..:.:|.:...:|             .|:.| |::..||||.|||.|:.||..||..| |.| 
  Fly     2 MKLLVCVLLVGSCTA-------------VPLLT-DVEPYITNGEPAEVGQFPYQAGLNVSFGNWS 52

  Fly    64 -WCGGSIIAHDWVLTAEHCIGDADSVTVYFGA----TWRTNAQFTHWVGNGNFIKHSS------- 116
             ||||::|:|.|::||.||:..|:|||||.||    ......|....|.....|.||:       
  Fly    53 TWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVV 117

  Fly   117 ADIALIRIP-HVDFWHMVNKVELP-SYNDRYNDYNEWWAVACGWGGTYDGS-PLPDYLQCVDLQI 178
            .||:|||:| .|.|...:....|| ..|.::..|....|.|.|||...|.| .:...|:.|::.|
  Fly   118 NDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPI 182

  Fly   179 IHNSECSGYY-GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK--LVGVTNFGSVAGCQSGAP 240
            :.:|.|..|: |:|.:.::|:.|..|||||.||||||||...|..  |:|.|:||:..|||.|.|
  Fly   183 MPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFP 247

  Fly   241 AGFQRVTYHLDWIRDH 256
            |.|.|::.:||||.:|
  Fly   248 AVFTRISSYLDWILNH 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 97/233 (42%)
Tryp_SPc 40..256 CDD:238113 99/235 (42%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 99/235 (42%)
Tryp_SPc 27..260 CDD:214473 97/232 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470932
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.