DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Jon74E

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:243 Identity:86/243 - (35%)
Similarity:123/243 - (50%) Gaps:21/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGYPAEEGKAPYTVGLGFSGG----WWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR- 97
            |||..|..|...:.||.|||.....    .|||.|:|:..::|||.||:..|.::|.|.|...| 
  Fly    30 GRIAGGELARANQFPYQVGLSIEEPNDMYCWCGASLISDRYLLTAAHCVEKAVAITYYLGGVLRL 94

  Fly    98 --------TNAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWA 153
                    ||.: .|...:.| .:....||||:|:|. ......:..:.||..:...|.|:...|
  Fly    95 APRQLIRSTNPE-VHLHPDWN-CQSLENDIALVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPA 157

  Fly   154 VACGWGGTYDGS-PLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVT 217
            :|.|||...|.| .:.|.|:.|...:..|.:|...|.::....:|:.|..|||||.||||||||.
  Fly   158 IASGWGRMNDESTAISDNLRYVYRFVESNEDCEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVY 222

  Fly   218 HDGTK----LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGIAY 261
            .|..:    |:|||::|..:||..|.|:.|.|:|.:||||.:.:|:.|
  Fly   223 SDPVQNADILIGVTSYGKKSGCTKGYPSVFTRITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 81/232 (35%)
Tryp_SPc 40..256 CDD:238113 82/234 (35%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
99.070

Return to query results.
Submit another query.