DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG4914

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:247 Identity:73/247 - (29%)
Similarity:115/247 - (46%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDA--DSVTVYFGATWRTN 99
            :.||..|......:.|:...|.:...::|||::|...:||||.||:...  ..:.|.||...|.|
  Fly   125 ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCN 189

  Fly   100 AQ-----------FTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWW 152
            .:           |:......||    ..||||:|: ..|.....:..:.||....|.:.:....
  Fly   190 DKERPETRFVLRAFSQKFSFSNF----DNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTK 250

  Fly   153 AVACGWGG-TYDGSPLPDYLQCVDLQIIHNSEC---SGY-YGSVGDNILCVRTP--DGKSTCGGD 210
            |:|.|||. ..||.| ...||.|::.::.|.||   :.| ...:..|::|...|  .|:.:|.||
  Fly   251 AIATGWGTLKEDGKP-SCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGD 314

  Fly   211 SGGPLV--THDGTKL--VGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRDHT 257
            ||||||  ..|..:.  :|:.::|:  || :...|..:.|||.:||||.:::
  Fly   315 SGGPLVRLRPDDKRFEQIGIVSWGN--GCARPNYPGVYTRVTKYLDWIVENS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/239 (30%)
Tryp_SPc 40..256 CDD:238113 72/241 (30%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 71/239 (30%)
Tryp_SPc 128..363 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.