DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and ctrb1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002944677.2 Gene:ctrb1 / 394984 XenbaseID:XB-GENE-977509 Length:263 Species:Xenopus tropicalis


Alignment Length:268 Identity:91/268 - (33%)
Similarity:131/268 - (48%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW-WCGGS 68
            ::.|||| .:..|...|::|     ||.|.  ..||.||..|..|..|:.|.|..|..| :||||
 Frog     7 VSCLALA-TTVYGCGQPQIA-----PVVTG--YARIVNGEEAVPGSWPWQVSLQDSTSWHFCGGS 63

  Fly    69 IIAHDWVLTAEHC-IGDADSVTVYFGATWR-TNAQ----------FTHWVGNGNFIKHSSADIAL 121
            :|.::||:||.|| :...|.|.:  |...| :|.:          |||...|.|.|.:   ||:|
 Frog    64 LINNEWVVTAAHCGVSTRDKVVL--GEHDRGSNVEKIQSLAVAKVFTHPQWNSNTINN---DISL 123

  Fly   122 IRI--PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGT-YDGSPLPDYLQCVDLQIIHNSE 183
            |::  |.| ....|..|.|.:..:.|....  ..|..|||.| |:....|:.||...|.::.|.:
 Frog   124 IKLATPAV-IGATVAPVCLANIGEDYEGGR--ICVTSGWGKTRYNAFTTPNQLQQTALPLLTNDQ 185

  Fly   184 CSGYYG-SVGDNILCVRTPDGKSTCGGDSGGPLV--THDGTKLVGVTNFGSVAGCQSGAPAGFQR 245
            |..|:| ::...::|.... |.|:|.||||||||  .:|...|||:.::|| :.|.:..||.:.|
 Frog   186 CKSYWGNNITGTMICAGAA-GSSSCMGDSGGPLVCQANDAWTLVGIVSWGS-SMCSTSTPAVYAR 248

  Fly   246 VTYHLDWI 253
            |.....|:
 Frog   249 VAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 80/232 (34%)
Tryp_SPc 40..256 CDD:238113 80/233 (34%)
ctrb1XP_002944677.2 Tryp_SPc 33..256 CDD:214473 80/232 (34%)
Tryp_SPc 34..259 CDD:238113 80/233 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.