DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and cfd

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_989320.1 Gene:cfd / 394945 XenbaseID:XB-GENE-973605 Length:265 Species:Xenopus tropicalis


Alignment Length:268 Identity:72/268 - (26%)
Similarity:110/268 - (41%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSII 70
            |:||:.:...       :||.:..|      :|||..|..::....||...:..:|...|||.:|
 Frog     6 ALLAVVLVLT-------VATYECRP------RGRILGGQDSKAEVRPYMASIQQNGIHQCGGVLI 57

  Fly    71 AHDWVLTAEHCIGDA--DSVTVYFGA-----------TWRTNAQFTHWVGNGNFIKHSSADIALI 122
            |..|||:|.||..::  .|:.|..||           ..:...:..|.:.|.. |||.  |:.|:
 Frog    58 ADKWVLSAAHCATNSSNSSLNVMLGAISLSKPEKYKIVVKVLREIPHPLYNST-IKHH--DLLLL 119

  Fly   123 RIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECS- 185
            .:.. |.....||  .||..|:..:.......:..|||........||.||.:.:.:|....|: 
 Frog   120 ELSEKVTLSPAVN--PLPFQNENIDISAGKRCLVAGWGQMRLTGKKPDTLQELWVPLISRDVCNR 182

  Fly   186 -GYY-GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAG-FQRVT 247
             .|| ..:..|::|. ....|.:|.||||||||. ||..:..|.  |....|.:....| :..:.
 Frog   183 RNYYDNEITANMICA-GESRKDSCEGDSGGPLVC-DGIAVAIVQ--GGFRKCGNPTKPGIYTLIE 243

  Fly   248 YHLDWIRD 255
            .:..||.:
 Frog   244 PYKSWIME 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/231 (27%)
Tryp_SPc 40..256 CDD:238113 64/234 (27%)
cfdNP_989320.1 Tryp_SPc 27..251 CDD:238113 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.