DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG10663

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:103/262 - (39%) Gaps:79/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGL--GFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTV------YFGAT 95
            :|..|..|.:|:.|:.|.:  .|... :|||::||..|||||.||:.....|.:      |...|
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEA-FCGGTLIAPRWVLTAAHCVRKVLFVRIGEHNLNYEDGT 569

  Fly    96 ---WRTNAQFTHWVGNGNFIKHS-SADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVAC 156
               .|....:||    .||.|.: .:|:||:|:|..     ||.             ..|...:|
  Fly   570 EIQLRVMKSYTH----PNFDKRTVDSDVALLRLPKA-----VNA-------------TTWIGYSC 612

  Fly   157 -----------------GWG--------GTYDGSPLPDYLQCVDLQIIHNSEC-SGYYG-SVGDN 194
                             |||        ||       ..|....:.||....| ..||. ::..|
  Fly   613 LPQPFQALPKNVDCTIIGWGKRRNRDATGT-------SVLHKATVPIIPMQNCRKVYYDYTITKN 670

  Fly   195 ILCVRTPDGK-STCGGDSGGPLVTHDGTK------LVGVTNFGSVAGCQSGAPAG-FQRVTYHLD 251
            :.|.....|. .||.|||||||:..|.||      :.|:|:||.  ||......| :.:|..::|
  Fly   671 MFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGD--GCAQRNKFGIYAKVPNYVD 733

  Fly   252 WI 253
            |:
  Fly   734 WV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/260 (28%)
Tryp_SPc 40..256 CDD:238113 73/261 (28%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 72/260 (28%)
Tryp_SPc 507..735 CDD:238113 72/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.