DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG18179

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:274 Identity:136/274 - (49%)
Similarity:170/274 - (62%) Gaps:19/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHT--KDMQGRITNGYPAEEGKAPYTVGL-----G 58
            ||.|  :|.|:||.|..|..|......|.|..|  :..:|||.|||||.||||||.|||     |
  Fly     1 MKLF--LLTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDG 63

  Fly    59 FSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKH------SSA 117
            .:......|:|||.||:|||.||: ..|.|.:::|:.|..|..|...|...|||.|      ...
  Fly    64 SNSAAVGAGTIIASDWILTAAHCL-TTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGR 127

  Fly   118 DIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNS 182
            ||.|||.|.|.|..::|||.|||:::..:.:.:.|.|||||||..:|: |.|:|||:|:|||.||
  Fly   128 DIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGN-LADWLQCMDVQIISNS 191

  Fly   183 ECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVT 247
            ||...||:|....:|.|..||||:|||||||||||||..:||||..|||| .|.|| |:|:.|||
  Fly   192 ECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSV-DCHSG-PSGYTRVT 254

  Fly   248 YHLDWIRDHTGIAY 261
            .:|.||||:|||:|
  Fly   255 DYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 114/224 (51%)
Tryp_SPc 40..256 CDD:238113 116/226 (51%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 114/224 (51%)
Tryp_SPc 40..263 CDD:238113 116/226 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470706
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.