DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG3088

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:264 Identity:120/264 - (45%)
Similarity:156/264 - (59%) Gaps:15/264 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGF-SGGWW 64
            ||..:..|.|.:.:|..|..           .::|....||||.||.||:|||.||:.| ....|
  Fly     1 MKLLVVFLGLTLVAAGSAKK-----------DSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIW 54

  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDF 129
            |.|:||...|:||:..|:..:..||:|||||..:.||||..||...::. .:..:||:|:|.|.|
  Fly    55 CSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVT-GNQHLALVRVPRVGF 118

  Fly   130 WHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS--VG 192
            .:.||:|.|||..:|...|..|||..||||.|...:.|.|.||||||||:.|:||..:|||  |.
  Fly   119 SNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVS 183

  Fly   193 DNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHT 257
            |.|||.|||.|:|||.||:|.||:|...:.:||::.|.:..||..|.||||.|:|..||||...|
  Fly   184 DQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRT 248

  Fly   258 GIAY 261
            ||||
  Fly   249 GIAY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 106/216 (49%)
Tryp_SPc 40..256 CDD:238113 108/218 (50%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 108/217 (50%)
Tryp_SPc 29..244 CDD:214473 106/215 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470803
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.