DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Jon66Ci

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:270 Identity:222/270 - (82%)
Similarity:237/270 - (87%) Gaps:18/270 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDM------QGRITNGYPAEEGKAPYTVGLGF 59
            ||.|:.||||||||||       |.|.:  ||.||:      :||||||||||||||||||||||
  Fly     1 MKVFLTILALAVASAS-------AYESV--VHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGF 56

  Fly    60 SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRI 124
            |||||||||||:::|||||||||| .|:||||||||||||||||||||:||||.|.|||||||||
  Fly    57 SGGWWCGGSIISNEWVLTAEHCIG-GDAVTVYFGATWRTNAQFTHWVGSGNFITHGSADIALIRI 120

  Fly   125 PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY- 188
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:.|| 
  Fly   121 PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYYG 185

  Fly   189 -GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDW 252
             |:|||||:|||..|||.|||||||||||||||:|||||||:.|.||||:|.|||||||||||||
  Fly   186 TGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDW 250

  Fly   253 IRDHTGIAYY 262
            ||||||||||
  Fly   251 IRDHTGIAYY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 191/215 (89%)
Tryp_SPc 40..256 CDD:238113 193/217 (89%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 191/215 (89%)
Tryp_SPc 37..254 CDD:238113 193/217 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470694
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.