DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:295 Identity:80/295 - (27%)
Similarity:122/295 - (41%) Gaps:87/295 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLTPVHTKDM-----------------------------QGRITNGYPAEEGKAPYTVGLGFSG- 61
            :|||:.:|.|                             |||.|    |.||:.|:...|...| 
Human   169 RLTPIDSKKMRNLLNSRCGIRMTSSNMPLPASSSTQRIVQGRET----AMEGEWPWQASLQLIGS 229

  Fly    62 GWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVG------------------- 107
            |..||.|:|::.|:|||.||.             |: |...|.|:.                   
Human   230 GHQCGASLISNTWLLTAAHCF-------------WK-NKDPTQWIATFGATITPPAVKRNVRKII 280

  Fly   108 -NGNFIKHSSA-DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPD 169
             :.|:.:.::. ||||::: ..|:|.::|.:|.||..:.:......  ....|:|...|..|:.:
Human   281 LHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTS--VFVTGFGSIVDDGPIQN 343

  Fly   170 YLQCVDLQIIHNSECSG---YYGSVGDNILCVRTPDGK-STCGGDSGGPLV--THDGTKLVGVTN 228
            .|:...::.|....|:.   |.|.:...:||....:|| ..|.||||||||  .||...:||:.:
Human   344 TLRQARVETISTDVCNRKDVYDGLITPGMLCAGFMEGKIDACKGDSGGPLVYDNHDIWYIVGIVS 408

  Fly   229 FGSVAGCQSGA----PAGFQRVTYHLDWIRDHTGI 259
            :|     ||.|    |..:.|||.:.|||...||:
Human   409 WG-----QSCALPKKPGVYTRVTKYRDWIASKTGM 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/246 (28%)
Tryp_SPc 40..256 CDD:238113 70/248 (28%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699
Tryp_SPc 205..432 CDD:214473 71/251 (28%)
Tryp_SPc 206..435 CDD:238113 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.