DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG33460

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:192 Identity:36/192 - (18%)
Similarity:69/192 - (35%) Gaps:53/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR-----TNAQFTHWVGNGNF 111
            |:|..|...|..:|.|::|...::|||..|| ..::|.|..|...|     ......|:......
  Fly    44 PWTALLHTDGSIFCAGTLITDVFILTAASCI-RPNAVKVRLGEFGRYPNELPEDHLVHYFLMYRL 107

  Fly   112 IKHSSA--DIALIRIPHVDFWHMVNKVELPSY--------NDRYNDYNEWWAVACGWGGTYDGSP 166
            ..:.|.  :|.|::        :..:|::..|        |.:....:....:...|   .:.|.
  Fly   108 FNNESLANNIGLLK--------LTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW---MEDSN 161

  Fly   167 L-------PDYLQ-----CVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLV 216
            :       |..:|     |.:|. ::...|:|:.|::             .:|.|.:|..|:
  Fly   162 VSLTKELRPIVIQSKPKMCTNLD-LYTQFCAGHQGNL-------------RSCDGLTGSALI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 36/192 (19%)
Tryp_SPc 40..256 CDD:238113 36/192 (19%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 36/192 (19%)
Tryp_SPc 44..249 CDD:214473 36/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.