DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG33465

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:286 Identity:68/286 - (23%)
Similarity:109/286 - (38%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSI 69
            :|::.|.:...    :.:|..:|   .|.......|...:.|.| .||:...:..:..:.|.|::
  Fly     7 LALIGLVLCQG----LAQLLDKK---CHDPKTSENINFNHGATE-TAPWMASIYKNNQFICDGTL 63

  Fly    70 IAHDWVLTAEHCIGDADSVTVYFGA--TWRTNAQF--THWVGNGNFIKHSS-------ADIALIR 123
            :...:||||..||.....:.|.||.  .:|..:||  ....|....::||:       .||.|:|
  Fly    64 VHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLR 128

  Fly   124 I-------PHV-------DFWHMVNKVELPSYNDRYNDYNEWWAVACGW--GGTYDGSPLPDYLQ 172
            :       .|:       |  |:|.....    :|:..:        ||  .||...|.:   .|
  Fly   129 LYGEVTHYAHIRPICIILD--HVVKSAPF----ERFEGF--------GWQQQGTEASSQV---RQ 176

  Fly   173 CVDLQIIHNSEC--SGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHD---GTK----LVGVTN 228
            .|.|......||  :|....:.:...|....| :|.|..:||.|| |.|   |.|    .||:.:
  Fly   177 TVYLSQKKPFECHRNGQLLPINEGQFCAGNRD-RSFCRSNSGSPL-TADFTYGVKNITVQVGLVS 239

  Fly   229 FGSVAGCQSGAPAG-FQRVTYHLDWI 253
            :||    :..:|.. :..|....|||
  Fly   240 YGS----ELCSPTSVYTDVVAFKDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/250 (24%)
Tryp_SPc 40..256 CDD:238113 63/251 (25%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 59/239 (25%)
Tryp_SPc 46..261 CDD:214473 57/237 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.