DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and yip7

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:278 Identity:135/278 - (48%)
Similarity:172/278 - (61%) Gaps:27/278 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKD------MQGRITNGYPAEEGKAPYTVGLGF 59
            ||.|: :|.||:||||...:|.:|     |||.:|      :.||||||..|..|:.||.|||.|
  Fly     1 MKVFV-VLVLALASASAGLLPNIA-----PVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSF 59

  Fly    60 S---GGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSS----- 116
            |   |.||||||||.::|||||.||...|.|||:|:|||.||:.:||..|.:..|.:|.|     
  Fly    60 SSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALT 124

  Fly   117 --ADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYD-GSPLPDYLQCVDLQI 178
              .||:||:...|.|...|||:.||:.::.|:.|....|||.|||.|.| .:.:...||.|||.|
  Fly   125 IRNDISLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTI 189

  Fly   179 IHNSECSGYYGS--VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPA 241
            |.||:|...:||  |...:|||.|.:..|||.|||||||.. ||. |:|.|:|||..||:|||||
  Fly   190 ISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL-DGV-LIGATSFGSADGCESGAPA 252

  Fly   242 GFQRVTYHLDWIRDHTGI 259
            .|.|:||:.|||::.:||
  Fly   253 AFTRITYYRDWIKETSGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 114/226 (50%)
Tryp_SPc 40..256 CDD:238113 115/228 (50%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 114/226 (50%)
Tryp_SPc 40..267 CDD:238113 115/228 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470860
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1110.900

Return to query results.
Submit another query.