DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and KLK1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:278 Identity:90/278 - (32%)
Similarity:123/278 - (44%) Gaps:55/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVA-SASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSII 70
            :|.||:: ..:||..|              :|.||..|:..|:...|:...|.....:.|||.::
Human     5 VLCLALSLGGTGAAPP--------------IQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILV 55

  Fly    71 AHDWVLTAEHCIGDADSVTVYFGATWRTN-------AQFTHWVGNG------------NFIKHS- 115
            ...|||||.|||  :|:..::.|   |.|       |||.| |...            |..:.: 
Human    56 HRQWVLTAAHCI--SDNYQLWLG---RHNLFDDENTAQFVH-VSESFPHPGFNMSLLENHTRQAD 114

  Fly   116 ---SADIALIRI--PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTY-DGSPLPDYLQCV 174
               |.|:.|:|:  |.......|..||||:.......    ..:|.|||... :....||.||||
Human   115 EDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGS----TCLASGWGSIEPENFSFPDDLQCV 175

  Fly   175 DLQIIHNSEC-SGYYGSVGDNILCV-RTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQS 237
            ||:|:.|.|| ..:...|.|.:||| ....||.||.|||||||:. ||. |.|||::|.|.....
Human   176 DLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMC-DGV-LQGVTSWGYVPCGTP 238

  Fly   238 GAPAGFQRVTYHLDWIRD 255
            ..|:...||..::.||.|
Human   239 NKPSVAVRVLSYVKWIED 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 80/241 (33%)
Tryp_SPc 40..256 CDD:238113 82/244 (34%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.