DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG15873

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:213 Identity:55/213 - (25%)
Similarity:86/213 - (40%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 WCGGSIIAHDWVLTAEHCIGD-------ADSVTVYFGATWR----TNAQF---THWVGNGNFIKH 114
            :|.|.:::...||||.||:.|       ...:.|.||...|    ..:.|   ...|.:..:.::
  Fly    68 FCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYERY 132

  Fly   115 SSADIALIRIP-------HVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQ 172
            ...|:|::|:.       |.....::.|....:|.|.        .:..|||..|...|..:.|.
  Fly   133 KKNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDT--------CITLGWGQIYQHGPYSNELV 189

  Fly   173 CVDLQIIHNSECSGYYGS-VGDNILCVRTPDGKS-TCGGDSGGPLVTHDGTKLVGVTNFGSVAGC 235
            .:|:.:...|.|..:|.: ..|:.:|.. |.|:| .|.||.||||:....  |.|:  .|...||
  Fly   190 YLDVILRPPSLCQKHYDTFTADHNVCTE-PVGESMNCAGDMGGPLLCKGA--LFGL--IGGHMGC 249

  Fly   236 QSGAPAGFQRVTYHLDWI 253
            ..|....|....|:.|||
  Fly   250 AGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/211 (25%)
Tryp_SPc 40..256 CDD:238113 55/213 (26%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 48/194 (25%)
Tryp_SPc 59..250 CDD:238113 48/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.