DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG32269

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:238 Identity:67/238 - (28%)
Similarity:98/238 - (41%) Gaps:39/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIG--DADSVTVYFGATWRT 98
            :|.||..|........||.|.|. .|...|.||:|...|||||.||:.  .|...||..|.|...
  Fly   105 IQSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLD 168

  Fly    99 NA--------------QFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYN 149
            .:              :||.        |..:.|.||:::........:..:.:.:|..:.... 
  Fly   169 GSDGVTRSVSSIHVAPKFTS--------KKMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSR- 224

  Fly   150 EWWAVACGWGGTYDGSPLPD-YLQCVDLQIIHNSECSGYY---GSVGDNILCVRTPDGKSTCGGD 210
               ....|||.|.:||.... .||...::::...:|...|   .::...:||.|.. ||.:|.||
  Fly   225 ---VRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAA-GKDSCSGD 285

  Fly   211 SGGPLVTHDGTKLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDW 252
            |||| ||.:.| |:|:.:||  .|| ::|.|..:..|.....|
  Fly   286 SGGP-VTRNNT-LLGIVSFG--YGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/235 (28%)
Tryp_SPc 40..256 CDD:238113 65/234 (28%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 65/233 (28%)
Tryp_SPc 121..324 CDD:238113 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.