DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG32270

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:233 Identity:69/233 - (29%)
Similarity:110/233 - (47%) Gaps:23/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAD--SVTVYFGATWRTNAQ 101
            ||..|:|::....|:.|.:...|.:.||||::....||||.||:.|.:  ...|..|.|:.::.:
  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMR 94

  Fly   102 FTHWVGNGNFIKHSSA--------DIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGW 158
            .:.:|..   |...||        |:||:::.......:...:.|...:.|...:    ....||
  Fly    95 NSRYVRK---ILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPRPGSF----VRVSGW 152

  Fly   159 GGTYDGS-PLPDYLQCVDLQIIHNSECSGY---YGSVGDNILCVRTPDGKSTCGGDSGGPLVTHD 219
            |.|...| .||:.||.|.:|::...||...   |.::..::.|...|..|..|.||||||:|..:
  Fly   153 GLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSN 217

  Fly   220 GTKLVGVTNFGSVAGCQS-GAPAGFQRVTYHLDWIRDH 256
            |. ||||.::|....|.: .:|..:..|:|..|||.|:
  Fly   218 GI-LVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/228 (29%)
Tryp_SPc 40..256 CDD:238113 67/230 (29%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 66/228 (29%)
Tryp_SPc 31..254 CDD:238113 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.