DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG9897

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:274 Identity:64/274 - (23%)
Similarity:104/274 - (37%) Gaps:87/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIG--DADSVTVYFGAT------ 95
            ||.||.......||:...:..:....|||:||:.:::|||..|:.  .|.|:.|..|.:      
  Fly    22 RIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQVRLGTSSCGTSG 86

  Fly    96 -------WRTNAQFTHWVGNGNFIKHSSADIALIR-------------IPHVDFWHMVNKVELPS 140
                   .:.::|::.|..:.|        :||::             |...|        ::|.
  Fly    87 SIAGICKVKVHSQYSSWRFDNN--------LALLKTCELLNTTDEIKPIERAD--------KVPD 135

  Fly   141 YNDRYNDYNEWWAVACGWGGTYDGS-------------------PLPDYLQCVDLQIIHNSECSG 186
            .|.|.|        ..|.||. .|:                   .||..|....::|:...:|:.
  Fly   136 DNSRAN--------VTGCGGR-SGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAA 191

  Fly   187 ------YY--GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGF 243
                  :|  ..:.|..:|.::| ||..|..|.|.|||..:  ||||:.   |.||| |..|..:
  Fly   192 DWKVIPFYLLKGISDLTICTKSP-GKGACSTDRGSPLVIDN--KLVGIL---SRAGC-SIKPDVY 249

  Fly   244 QRVTYHLDWIRDHT 257
            ..:..|.:|:..:|
  Fly   250 ANILGHTNWLDSNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 62/268 (23%)
Tryp_SPc 40..256 CDD:238113 62/270 (23%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 62/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.