DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30283

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:285 Identity:83/285 - (29%)
Similarity:128/285 - (44%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAFIAILALAVASA------SGATMPRLATEKLTPVHTKDM-QGRITNGYPAEEGKAPYTVGLGF 59
            |.|:.::.||.:|.      ||:.:..       |..|..: |.:|..|:.|....||:...:..
  Fly     5 KIFVVVVLLAASSVVVLGSESGSFLEH-------PCGTVPISQFKILGGHNAPVASAPWMAMVMG 62

  Fly    60 SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWR--------TNAQFTHWVGNGNFIKHSS 116
            .||:.|||::|.:.:|||:.|||.:.: :.|..|...|        .:|.|.|  .:..|.:|  
  Fly    63 EGGFHCGGTLITNRFVLTSAHCIANGE-LKVRLGVLEREAEAQKFAVDAMFVH--TDYYFDQH-- 122

  Fly   117 ADIALIRI-PHVDFWHMVNKV---------ELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYL 171
             |:||:|: ..|.:...::.:         .:..:..::..|        |||.|...|. ...|
  Fly   123 -DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY--------GWGKTESRSS-SRML 177

  Fly   172 QCVDLQIIHNSECSGYY--GSVGDNILCVRTPDGKSTCGGDSGGPL---VTHDGTKLV---GVTN 228
            |...|..:|.|||:..|  ..:..|.:|..:.:. :||.|||||||   ||:|..::|   |||:
  Fly   178 QKTSLFNLHRSECAKQYPHQQINRNHICAESANA-NTCNGDSGGPLTAIVTYDHVQMVFQFGVTS 241

  Fly   229 FGSVAGCQSGAPAGFQRVTYHLDWI 253
            ||. |.|.....  |..|..|||||
  Fly   242 FGH-ADCSKATV--FTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/239 (30%)
Tryp_SPc 40..256 CDD:238113 73/240 (30%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 71/239 (30%)
Tryp_SPc 43..266 CDD:238113 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.