DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG11192

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:290 Identity:77/290 - (26%)
Similarity:115/290 - (39%) Gaps:87/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDW 74
            :|:.:.:|||.        ||     ..|||..|..|...:.||.|.:...|...|||:||..|.
  Fly    11 MALVAYAGATP--------TP-----GDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDT 62

  Fly    75 VLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSA---------------------- 117
            ||||.||..|          .| ::|.:|..||:.   :|.|.                      
  Fly    63 VLTAAHCFED----------PW-SSADYTVRVGSS---EHESGGHVLSLRRVIAHGDYNPQSHDN 113

  Fly   118 DIALIRI-PHVDFWHMVNKVEL------PSYNDRYNDYNEWWAVACGWG---------GTYDGSP 166
            |:||:.: ..::|...:..|.|      |:.:.|..        ..|||         |....||
  Fly   114 DLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQ--------VSGWGFQAEESAVSGEVGVSP 170

  Fly   167 LPDYLQCVDLQIIHNSECSGYYGSV---GDNILCVRTPDGKSTCGGDSGGPLV---THDG-TKLV 224
               .|:.||:.::.:::|...|..|   ...::|...| |:.:|.||||||||   ..:| .:|.
  Fly   171 ---QLRFVDVDLVESNQCRRAYSQVLPITRRMICAARP-GRDSCQGDSGGPLVGYAAEEGPARLY 231

  Fly   225 GVTNFGSVAGCQS-GAPAGFQRVTYHLDWI 253
            |:.::|  .||.: ..|..:..|.....||
  Fly   232 GIVSWG--LGCANPNFPGVYTNVAAFRSWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/259 (26%)
Tryp_SPc 40..256 CDD:238113 69/260 (27%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 68/259 (26%)
Tryp_SPc 28..262 CDD:238113 69/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.