DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG10764

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:237 Identity:62/237 - (26%)
Similarity:96/237 - (40%) Gaps:35/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFT 103
            :|:.|..|.|..:.:...:..|..:.|||:||...:||:|.||:.....:.|..||.........
  Fly    37 KISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAV 101

  Fly   104 HWVGNGNFIKHS------SADIALIRIPHVDFWHMVNKVEL--------PSYNDRYNDYNEWWAV 154
            |.|.| .|:.|.      ..||.|:::..    .:|..|.:        |:..........:.|:
  Fly   102 HTVIN-VFVHHDFIASEYRNDIGLLQLSE----SIVYTVRVQPICIFLDPALKGSVEKLKTFRAL 161

  Fly   155 ACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCVRTPDGKSTCGGDSGGPLVTH 218
              |||..  ...|...||.:.|..:..:||..... ::....:|..|.:| .||.|||||||.|:
  Fly   162 --GWGNR--NGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNG-DTCRGDSGGPLSTN 221

  Fly   219 ---DGTK----LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
               ...|    .:|:.:||.......|.   :..||.::|||
  Fly   222 ILFPSNKSYEVQLGIVSFGDPECRGVGV---YTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 60/235 (26%)
Tryp_SPc 40..256 CDD:238113 62/236 (26%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 60/235 (26%)
Tryp_SPc 38..263 CDD:238113 62/236 (26%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.