DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss48

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:258 Identity:77/258 - (29%)
Similarity:117/258 - (45%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGA 94
            ||||    |||..|..|..|:.|:.|.|.|.....||||:|:..|||||.|||          ..
Mouse    34 PVHT----GRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCI----------KK 84

  Fly    95 TWRTNAQFTHWVGNGN----------FI---------KHSSADIALIRI-PHVDFWHMVNKVELP 139
            || .:..::.|:|:.:          ::         :|:.|||||::: ..|.|..::..:.||
Mouse    85 TW-YSFLYSVWLGSIDREYSSTGKEYYVSRIAIPDKHRHTEADIALLKLSSRVTFSSVILPICLP 148

  Fly   140 SYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVG-----------D 193
            :.:.:.......|..  |||...:|. .|..||.:::.:|.:..|...|..:|           :
Mouse   149 NISKQLTVPASCWVT--GWGQNQEGH-YPSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIKE 210

  Fly   194 NILCV-RTPDGKSTCGGDSGGPLVTH-DGT-KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            ::.|. .....|.:|.|||||||..| ||. :|:||.::|  ..|....|..:..|||:..||
Mouse   211 DMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWG--LECGKDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/247 (28%)
Tryp_SPc 40..256 CDD:238113 71/248 (29%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 70/247 (28%)
Tryp_SPc 40..274 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.