DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tmprss4

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:236 Identity:75/236 - (31%)
Similarity:115/236 - (48%) Gaps:31/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFT 103
            |:..|..|.....|:.|.:.::....|||||:.|.|:|||.||......|     ::|:..|. :
  Rat   245 RVVGGVEASADSWPWQVSIQYNKQHVCGGSILDHHWILTAAHCFRKYLDV-----SSWKVRAG-S 303

  Fly   104 HWVGNG-------------NFIKHSSADIALIRIP-HVDFWHMVNKVELPSYNDRYNDYNEWWAV 154
            :.:||.             |.::....||||:::. .:.|...|..:.||..::........|.:
  Rat   304 NKLGNSPSLPVAKIFIAEPNPLQPKEKDIALVKLKMPLTFSGSVRPICLPFSDEELIPTMPVWVI 368

  Fly   155 ACGWGGTYD-GSPLPDYLQCVDLQIIHNSECS---GYYGSVGDNILCVRTPD-GKSTCGGDSGGP 214
              |||.|.: |..:.|.|....:|:|.::.|:   .|.|.|...:||..||. ||.||.||||||
  Rat   369 --GWGFTEENGGKMSDTLLQASVQVIDSARCNAEDAYQGEVTAGMLCAGTPQGGKDTCQGDSGGP 431

  Fly   215 LVTH-DGTKLVGVTNFGSVAGCQS-GAPAGFQRVTYHLDWI 253
            |:.| |..::||:.::|  .||.| ..|..:.:||.:||||
  Rat   432 LMYHYDKWQVVGIVSWG--YGCGSPSTPGVYTKVTAYLDWI 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/234 (31%)
Tryp_SPc 40..256 CDD:238113 74/235 (31%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346
Tryp_SPc 245..470 CDD:214473 73/234 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.