DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Prss56

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:252 Identity:67/252 - (26%)
Similarity:100/252 - (39%) Gaps:42/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATW 96
            :|....|||..|..|..|..|:.|.|...|...|||.::|..|||||.||...|.:..:     |
  Rat   104 NTTRAHGRIVGGSTAPLGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELL-----W 163

  Fly    97 RT------NAQFTHWVGNGNFIKHSS-------ADIALIRIPHVDFWHMVNK------VELPSYN 142
            ..      ..:....|.....:.|..       .|:||:::     |..||.      :.||. .
  Rat   164 TVMLAEGPQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQL-----WTPVNSEGPARPICLPE-G 222

  Fly   143 DRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS--VGDNILCV-RTPDGK 204
            .|.........:| |||..::..|..:.::...:.::....|....|.  ....:||. ....|.
  Rat   223 SREPPAGTPCTIA-GWGALFEDGPESEAVREARVPLLSADTCQKALGPGLSPSTMLCAGYLAGGI 286

  Fly   205 STCGGDSGGPLV-THDGTK----LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRD 255
            .:|.|||||||. :..|.:    |.|||::|.  || :.|.|..:.||....||:::
  Rat   287 DSCQGDSGGPLTCSEPGPRPREVLFGVTSWGD--GCGEPGKPGVYTRVAVFKDWLQE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 64/241 (27%)
Tryp_SPc 40..256 CDD:238113 64/244 (26%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.