DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG13744

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:266 Identity:71/266 - (26%)
Similarity:106/266 - (39%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGD 84
            :||.|...|        |.||..|.||:..:.|:...:..: .:.|||.:|:.:.|.||.|||..
  Fly   130 VPRTAQNTL--------QKRIIGGRPAQFAEYPWQAHIRIA-EYQCGGVLISANMVATAAHCIQQ 185

  Fly    85 AD--SVTVYFGATWRTN----------------AQFTHWVGNGNFIKHSSADIALIRIPH-VDFW 130
            |.  .:|||.|.....:                .:..|...|....:....||||:::.. ..|.
  Fly   186 AHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFT 250

  Fly   131 HMVNKVELPSYNDRYNDYNEWWAVACGWGGT--YDGSPLPDYLQCVDLQIIHNSECSGYYGSVGD 193
            ..:..:.||.|..|.....   .:..|||.|  :.|....:.||...:.||...:|..::.|...
  Fly   251 EHILPICLPQYPIRLIGRK---GLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQI 312

  Fly   194 NI------LCVRTPDG-KSTCGGDSGGPLVTHDGTK--LVGVTNFGSVAGCQSGAPAGFQRVTYH 249
            |:      .|....|| ...|.||||||||..:..:  |||:|:.|...|... .|..:..|...
  Fly   313 NVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDH-QPGIYHNVQKT 376

  Fly   250 LDWIRD 255
            :.||::
  Fly   377 VRWIQE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 64/243 (26%)
Tryp_SPc 40..256 CDD:238113 65/246 (26%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 64/243 (26%)
Tryp_SPc 142..383 CDD:238113 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
11.000

Return to query results.
Submit another query.