DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG30371

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:248 Identity:67/248 - (27%)
Similarity:105/248 - (42%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGL---GFSGGWWCGGSIIAHDWVLTAEHCI---GDADSVTVYFGATWR 97
            ||.||..|...:.|....|   ..:...:|||:|:||.::|||.|||   ..|.::....|....
  Fly   149 RIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDL 213

  Fly    98 TNAQFTHWVGNGN---FIKHS--------SADIA-LIRIPHVDFWHMVNKVELPSYNDRYNDYNE 150
            .|...:.:....|   .|.|.        :.||| ||...::.:...|..:.||..... ..:..
  Fly   214 GNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICLPPVGTS-TPFTY 277

  Fly   151 WWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVG---DNILCVRTPD----GKSTCG 208
            ......|:|..:...|....||.::|.::.|.:|...|.:|.   ...:|  |.|    |:.:|.
  Fly   278 DLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTGQMC--TYDYSGTGRDSCQ 340

  Fly   209 GDSGGPLVTHDGTK-LVGVTNFGSVAGC-QSGAPAGFQ-RVTYHLDWIRDHTG 258
            .|||||::.....: |||:.::|.  .| :|..|.|.. |:|.::.|||...|
  Fly   341 FDSGGPVILRKSRQFLVGIISYGK--SCAESQYPMGVNTRITSYISWIRQKIG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/241 (26%)
Tryp_SPc 40..256 CDD:238113 65/243 (27%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 63/241 (26%)
Tryp_SPc 150..389 CDD:238113 65/243 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.