DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and try-9

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:263 Identity:57/263 - (21%)
Similarity:91/263 - (34%) Gaps:97/263 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGS------IIAH-------DW-VLTAEHCIG--- 83
            |:.||::|                ||.:..||:      .:.|       .| ::||.|.||   
 Worm     1 MKKRISDG----------------SGSFRNGGNKFSENEFVQHGTGTLVSPWHIVTAAHLIGISE 49

  Fly    84 ----DADSVTV---YFGATWRTNAQFTH-------------------------------WVGNGN 110
                |.|:..:   ||...::....|.:                               :||:|.
 Worm    50 DPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGC 114

  Fly   111 FIKHSSADIALIRIPH-VDFWHMVNKVELPSY----NDRYNDYNEWWAVACGWGGTYDGSPLPDY 170
            ..:.|..|||:..:.. ::|...:....|||.    ..|...|..:     |:|    ..|....
 Worm   115 IDRESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGYKLF-----GYG----RDPSDSV 170

  Fly   171 LQCVDLQIIHN--SECSG--YYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK----LVGVT 227
            |:...|:.:::  :|||.  .||.|    .|....:...:|.||||..:|....|:    ||||.
 Worm   171 LESGKLKSLYSFVAECSDDFPYGGV----YCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVL 231

  Fly   228 NFG 230
            :.|
 Worm   232 SAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 56/260 (22%)
Tryp_SPc 40..256 CDD:238113 55/259 (21%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.