DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and scaf

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:76/211 - (36%) Gaps:43/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIIAHDWVLTAEHCIGDADSVTVYFGA-TWR---TNA----QFTHWVGNGNFIKH------- 114
            |||:||...:||::..|:.......:...| .|.   ||.    |.|   |......|       
  Fly   450 CGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLT---GVKTVDVHPDYDPST 511

  Fly   115 SSADIALIRIP-HVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG----GTYDGSPLPDYLQCV 174
            :|.|:|:||:. .::|...:..:.:...:.:.::.    ....|||    ..::...|   :...
  Fly   512 NSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQ----CFTSGWGKQALSIHEEGAL---MHVT 569

  Fly   175 DLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGT--KLVGVTNFGSVAGCQS 237
            |......||||....||     |..|.  ..:|..|.|..|....|:  :|.|:  |.....|..
  Fly   570 DTLPQARSECSADSSSV-----CSATK--FDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGE 625

  Fly   238 GAPAGFQRVTYHLDWI 253
            |....|.:.  .:.||
  Fly   626 GQTVRFAKP--DIKWI 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 46/209 (22%)
Tryp_SPc 40..256 CDD:238113 48/211 (23%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 41/182 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.